PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla020132
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family LBD
Protein Properties Length: 318aa    MW: 35607.8 Da    PI: 7.5354
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla020132genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.97e-4371061100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk++rrkC+++Cv+apyfp +qp+kfanvhk+FGasnv kll++l+ ++reda++sl+yeAe r+rdPvyG+vg+i+ lq++l+q++++l  +k+e
  Cla020132   7 PCAACKIQRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNELNATQREDAVNSLAYEAEFRLRDPVYGCVGLISVLQHKLKQMQSDLYNAKKE 106
                7********************************************************************************************9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7196107IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-427104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MSSSNSPCAA CKIQRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK LLNELNATQR  60
EDAVNSLAYE AEFRLRDPVY GCVGLISVLQ HKLKQMQSDL YNAKKELASY IGPQAMLPIL  120
QPQPQPPTPT PSSSALLPYN ISPMLAIPPS AAPGSSQQML IPPQHQMQQQ QQQQQLFEAQ  180
QLAAAVAARE QQEMFRAYEH KQSHHHHQQQ QRQHELLRFN GFDAGGGFNN QMNSSPSNLT  240
LGTFVDNTYQ IQTQPEHSHS HSHSHSHSHS PLQVQLFLQP QQTQLDQPQH PHPHQSHKPE  300
TTPADDGRNN NINIGPSC
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819131e-115LN681913.1 Cucumis melo genomic scaffold, anchoredscaffold00045.
GenBankLN7132651e-115LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012491765.11e-100PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ39e-86LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0B0PS921e-115A0A0B0PS92_G
STRINGVIT_07s0197g00020.t013e-97(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.14e-64ASYMMETRIC LEAVES 2-like 1